PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr035927.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 362aa    MW: 39263.5 Da    PI: 5.3067
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr035927.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13.1e-164388147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd  l ++v  +G ++W++Iar +  gR++k+c++rw + 
      Pbr035927.1 43 KGPWSPEEDAVLTRLVSNFGARNWSLIARGID-GRSGKSCRLRWCNQ 88
                     79******************************.***********985 PP

2Myb_DNA-binding56.65.7e-1895139147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T eEd  +v a++ +G++ W++Iar ++ gRt++ +k++w++ 
      Pbr035927.1  95 RKPFTDEEDRMIVAAHAIHGNK-WAAIARLLP-GRTDNAIKNHWNST 139
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.543889IPR017930Myb domain
SuperFamilySSF466897.91E-3041136IPR009057Homeodomain-like
SMARTSM007174.2E-134291IPR001005SANT/Myb domain
PfamPF002494.9E-154388IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-264496IPR009057Homeodomain-like
CDDcd001679.51E-134587No hitNo description
PROSITE profilePS5129426.7690144IPR017930Myb domain
SMARTSM007172.3E-1794142IPR001005SANT/Myb domain
PfamPF002494.2E-1595139IPR001005SANT/Myb domain
CDDcd001673.65E-1397140No hitNo description
Gene3DG3DSA:1.10.10.604.5E-2497143IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
METEVADHPA AVDIDAGYGG GDSGEEAGAG GGSRRKSGRD NVKGPWSPEE DAVLTRLVSN  60
FGARNWSLIA RGIDGRSGKS CRLRWCNQLD PAVKRKPFTD EEDRMIVAAH AIHGNKWAAI  120
ARLLPGRTDN AIKNHWNSTL KRRCMDPDRI KLESGNMVED VSCDKTKGSS EETFSYGDVN  180
SSKSMEGREV SSLEHMDDQD EYNGSSEVQF SHEATEQPTL FRPMARISAF SVYNQSNSQE  240
PASSFPRPIP VQGPLVQASK LDVGINKFLE GVYGERSVPD QCGHGCCRAQ SGMNFQNSLL  300
GPELVEFSEP PLFPTFELAA IATDISNLAW LKSGLENNSV RAVGETAGRI TTHGSRPNGA  360
F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-41401434107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744590.0DQ074459.1 Malus x domestica MYB2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008388098.10.0PREDICTED: transcription factor MYB44-like
TrEMBLD9ZJ630.0D9ZJ63_MALDO; MYB domain class transcription factor
STRINGVIT_08s0007g01540.t011e-168(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39863362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09230.12e-99myb domain protein 1